FIXP_SINMW C-type cytochrome. Part of the cbb3-type cytochrome c oxidase complex. FixP subunit is required for transferring electrons from donor cytochrome c via its heme groups to FixO subunit. From there, electrons are shuttled to the catalytic binuclear center of FixN subunit where oxygen reduction takes place. The complex also functions as a proton pump (By similarity). Cbb3-type cytochrome c oxidase subunit FixP fixP C-type cytochrome FixP 289 Smed_5932 Smed_6265 Cytochrome c oxidase subunit III MADKHKHVDEVSGVETTGHEWDGIRELNNPLPRWWVYSFYATIIWAIGYAVAYPSWPMLTEATKGVLGYSSRAEVGVELAAAKAAQAGNLEQIALNSVEEIIANPQLQQFAVSAGASVFKVNCAQCHGSGAAGGQGFPNLNDDDWLWGGKPQEIYQTIAHGVRHATDGETRGSEMPPFGDMLTPEQMQQTAAYVMSLTQAPSQPHLVEQGKQVFADNCASCHGADAKGNREMGAPNLADAIWLYGEGEQAVIAQMKTPKHGVMPAWLPRLGDPVVKELAVFVHSLGGGE